PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_004366-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 424aa    MW: 48153 Da    PI: 4.9332
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_004366-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.95.4e-19176222148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W+teEd +lvd+vk++G++ W+ Ia+++  gR +kqc++rw+++l
    NNU_004366-RA 176 KGQWSTEEDSKLVDLVKEYGMKKWSYIAERLE-GRKGKQCRERWYNHL 222
                      799*****************************.*************97 PP

2Myb_DNA-binding57.72.8e-18229270245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + WT+eEd  l++a+++lG++ W+ Ia++++ gRt++++k++w+
    NNU_004366-RA 229 DGWTEEEDTVLIQAHAELGNK-WAEIAKRLP-GRTENSIKNHWN 270
                      56*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.197171226IPR017930Myb domain
SuperFamilySSF466897.19E-31173269IPR009057Homeodomain-like
SMARTSM007171.4E-15175224IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-27177230IPR009057Homeodomain-like
PfamPF139213.0E-17179236No hitNo description
CDDcd001677.45E-15179222No hitNo description
SMARTSM007172.9E-17227275IPR001005SANT/Myb domain
PROSITE profilePS5129422.308227277IPR017930Myb domain
CDDcd001672.29E-13231273No hitNo description
Gene3DG3DSA:1.10.10.606.9E-23231275IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MEFETTYRDD LALRPVSWSE NCLEPHLGDG FSLEVSSSTG YFQELWKFVD GSSSDTEFGF  60
STLFFDHLEA IASGYSTVLD VYKPKPITED CGNGIMEIFQ NTGLLSYTQR TPETTVIELD  120
RSHLFLQRIE SPNSGLPDEI SCITWENGPY KEVGLKKRSV AMRKAGKFQK RKNVVKGQWS  180
TEEDSKLVDL VKEYGMKKWS YIAERLEGRK GKQCRERWYN HLRPDIKKDG WTEEEDTVLI  240
QAHAELGNKW AEIAKRLPGR TENSIKNHWN ATKRRLLSKR RCRSSKCSKS NSLLQNYIKS  300
LSSTAVSTGP DEYLQNMFTD SSNASVHTTM EPTTQLQSTD FCPGDDPPVP SDDSNDASEF  360
SFATTLFSVE HGIESLFQEI SCATVLDKQH LDMGDMALDM ITLMDGEVKR EMDLLEMIAQ  420
SNPI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-451742752103C-Myb DNA-Binding Domain
1msf_C3e-451742752103C-Myb DNA-Binding Domain
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251366.10.0PREDICTED: transcription factor MYB98-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-55myb domain protein 98